PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552948.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 568aa    MW: 63504.6 Da    PI: 4.3524
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552948.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.3e-5291361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat++gyWk+tgkd+e+ 
  XP_010552948.1   9 LAPGFRFHPTDEELVRYYLKRKICNKPFRF-DAISVIDIYKSEPWDLPdKsKLKSRDLEWYFFSVLDKKYGNGSKTNRATEKGYWKTTGKDREIR 102
                     579**************************9.99**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + + ++vg+kktLv++kgrap+ge+t+Wvmheyrl
  XP_010552948.1 103 N-GPRVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-627159IPR003441NAC domain
PROSITE profilePS5100558.459159IPR003441NAC domain
PfamPF023658.2E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK ICNKPFRFDA ISVIDIYKSE PWDLPDKSKL  60
KSRDLEWYFF SVLDKKYGNG SKTNRATEKG YWKTTGKDRE IRNGPRVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLVDDE LGKAGVAQDA YVLCRIFQKS GSGPKNGEQY GAPFIEEEWE  180
DDEMVFVPDQ DAMSDEGLAV DDNDVYVDMD DIDQKPGNDE IFDAIPLPSN FYHGESSNNI  240
ESGNYSESGN YIQPGNYVDT SCYFAQPTDS SEEDQKPIIR TGEIQPVLVL PDEQIDCDVQ  300
EENTDNFQTP NNIFSAETSY SGIPDDNYLL QEPLMDPDNN LPLNDGLYLE TDDLSLTNHD  360
SFNFEDYLTF FDGDDEFTPQ LTFNASQLVG TEGSVPHVEG ITEKAVPEVL EKEASTSKHV  420
MEEKDKSEAS CSRQDPDALK FESDSKYPFL KKASEMLGAI PAPPAFASEF PTKVAAMHLH  480
SAAQSSGSVH VTAGMIRISN MTIAAGSGMD WSYGKNGSLN VVLSLGLVEQ TETGKLGRTL  540
SRAMLIFVCF WVLILSVSFK VGTFVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-46816516171NO APICAL MERISTEM PROTEIN
1ut4_B6e-46816516171NO APICAL MERISTEM PROTEIN
1ut7_A6e-46816516171NO APICAL MERISTEM PROTEIN
1ut7_B6e-46816516171NO APICAL MERISTEM PROTEIN
3swm_A6e-46816519174NAC domain-containing protein 19
3swm_B6e-46816519174NAC domain-containing protein 19
3swm_C6e-46816519174NAC domain-containing protein 19
3swm_D6e-46816519174NAC domain-containing protein 19
3swp_A6e-46816519174NAC domain-containing protein 19
3swp_B6e-46816519174NAC domain-containing protein 19
3swp_C6e-46816519174NAC domain-containing protein 19
3swp_D6e-46816519174NAC domain-containing protein 19
4dul_A6e-46816516171NAC domain-containing protein 19
4dul_B6e-46816516171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552948.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLV4LD690.0V4LD69_EUTSA; Uncharacterized protein
STRINGscaffold_600382.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2